Products

Jump to Filters
View as table Download
TAC1 Rabbit Polyclonal Antibody
TA342648

USD 375.00

5 Days

Rabbit Polyclonal Anti-TAC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAC1 antibody: synthetic peptide directed towards the middle region of human TAC1. Synthetic peptide located within the following region: MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEH
TAC1 Rabbit Polyclonal Antibody
TA382265

USD 220.00

3 Weeks

TAC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human TAC1 (NP_003173.1).
Modifications Unmodified