Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR78 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR78. Synthetic peptide located within the following region: MVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDS |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR78 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR78. Synthetic peptide located within the following region: ILSKCLTYSKAVADPFTYSLLRRPFRQVLAGMVHRLLKRTPRPASTHDSS |
Rabbit Polyclonal Anti-GPR78 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human GPR78 |
Germany
Japan
United Kingdom
China