Goat Anti-PSMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NLYELKEGRQ, from the internal region of the protein sequence according to NP_002786.2. |
Goat Anti-PSMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NLYELKEGRQ, from the internal region of the protein sequence according to NP_002786.2. |
Rabbit polyclonal Anti-PSMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF |