Products

View as table Download

Rabbit Polyclonal Antibody against PDK3 (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PDK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PDK3.

Rabbit Polyclonal Anti-PDK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDK3 antibody: synthetic peptide directed towards the middle region of human PDK3. Synthetic peptide located within the following region: IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK

Rabbit Polyclonal Anti-PDK3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDK3 antibody: synthetic peptide directed towards the N terminal of human PDK3. Synthetic peptide located within the following region: RPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVV