Rabbit Polyclonal CTRP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTRP1 (NT) antibody was raised against a 15 amino acid peptide from near the amino-terminus of human CTRP1. |
Rabbit Polyclonal CTRP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CTRP1 (NT) antibody was raised against a 15 amino acid peptide from near the amino-terminus of human CTRP1. |
CTRP1 (C1QTNF1) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human C1QTNF1 |
Rabbit Polyclonal CTRP1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CTRP1 (IN) antibody was raised against a 16 amino acid peptide from near the center of human CTRP1. |
Rabbit Polyclonal Anti-C1QTNF1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1QTNF1 antibody: synthetic peptide directed towards the N terminal of human C1QTNF1. Synthetic peptide located within the following region: YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS |