Rabbit polyclonal antibody to Malectin (Malectin)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 292 of Malectin (Uniprot ID#Q14165) |
Rabbit polyclonal antibody to Malectin (Malectin)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 292 of Malectin (Uniprot ID#Q14165) |
Rabbit Polyclonal Anti-KIAA0152 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KIAA0152 antibody: synthetic peptide directed towards the C terminal of human KIAA0152. Synthetic peptide located within the following region: TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP |