Rabbit polyclonal anti-Ephrin-B3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Ephrin-B3. |
Rabbit polyclonal anti-Ephrin-B3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Ephrin-B3. |
Rabbit anti Ephrin B3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant full length (1-340aa) human Ephrin-B34 protein expressed in E.coli. |
Rabbit Polyclonal Anti-EFNB3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Efnb3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Efnb3. Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE |
Rabbit Polyclonal Anti-EFNB3 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human EFNB3 |
EFNB3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |