Products

Jump to Filters
View as table Download
Semaphorin 3D (SEMA3D) (C-term) Rabbit Polyclonal Antibody
AP53844PU-N

USD 450.00

2 Weeks

Semaphorin 3D (SEMA3D) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 610-640 amino acids from the C-terminal region of Human SEMA3D
Semaphorin 3D (SEMA3D) Rabbit Polyclonal Antibody
TA329786

USD 375.00

5 Days

Rabbit polyclonal Anti-SEMA3D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA3D antibody: synthetic peptide directed towards the middle region of human SEMA3D. Synthetic peptide located within the following region: LECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
Semaphorin 3D (SEMA3D) Mouse Monoclonal Antibody [Clone ID: OTI2H4]
CF809917

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SEMA3D mouse monoclonal antibody,clone OTI2H4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated