Products

View as table Download

Rabbit polyclonal MASP1 (heavy chain, Cleaved-Arg448) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MASP1.

Rabbit Polyclonal Anti-MASP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP1 antibody is: synthetic peptide directed towards the N-terminal region of Human MASP1. Synthetic peptide located within the following region: PGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHN