Products

View as table Download

Rabbit Polyclonal Anti-BPGM Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPGM antibody: synthetic peptide directed towards the C terminal of human BPGM. Synthetic peptide located within the following region: LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK

Rabbit Polyclonal Anti-BPGM Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPGM antibody: synthetic peptide directed towards the middle region of human BPGM. Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK

Rabbit Polyclonal antibody to BPGM (2,3-bisphosphoglycerate mutase)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 246 of BPGM (Uniprot ID#P07738)

BPGM (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 229-259 amino acids from the C-terminal region of human BPGM