Products

View as table Download

Goat Polyclonal Antibody against LDHC (aa 221 - 233)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DSDKEHWKNVHKQ, from the internal region of the protein sequence according to NP_002292.1; NP_059144.1.

Rabbit Polyclonal Anti-LDHC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHC Antibody: synthetic peptide directed towards the middle region of human LDHC. Synthetic peptide located within the following region: IVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPV

Goat Polyclonal Antibody against LDHC (aa 217 - 231)

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KLGTDSDKEHWKNIH, from the Internal region of the protein sequence according to NP_002292.1; NP_059144.1.