Products

Jump to Filters
View as table Download
P2RY5 (LPAR6) (Center) Rabbit Polyclonal Antibody
AP52517PU-N

USD 450.00

2 Weeks

P2RY5 (LPAR6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen KLH conjugated synthetic peptide between 106-134 amino acids from the Central region of Human P2RY5 / LPAR6
P2RY5 (LPAR6) Rabbit Polyclonal Antibody
TA331336

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPAR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human LPAR6. Synthetic peptide located within the following region: VAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKNWSVRRSDFR
P2RY5 (LPAR6) Rabbit Polyclonal Antibody
TA331337

USD 375.00

5 Days

Rabbit Polyclonal Anti-LPAR6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LPAR6 antibody is: synthetic peptide directed towards the N-terminal region of Human LPAR6. Synthetic peptide located within the following region: GDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAK