Rabbit Polyclonal Anti-COLEC11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-COLEC11 Antibody is: synthetic peptide directed towards the N-terminal region of Human COLEC11. Synthetic peptide located within the following region: RETKAPPDGLEESAPREKKQSQPVVTASDISKRKCTSSFVEMGSQGDMGD |
COLEC11 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human COLEC11 |
COLEC11 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-271 of human COLEC11 (NP_076932.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China