Products

View as table Download

Rabbit Polyclonal Anti-BPGM Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPGM antibody: synthetic peptide directed towards the C terminal of human BPGM. Synthetic peptide located within the following region: LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK

Rabbit Polyclonal Anti-BPGM Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BPGM antibody: synthetic peptide directed towards the middle region of human BPGM. Synthetic peptide located within the following region: EQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLK

Rabbit Polyclonal antibody to BPGM (2,3-bisphosphoglycerate mutase)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 246 of BPGM (Uniprot ID#P07738)

BPGM (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 229-259 amino acids from the C-terminal region of human BPGM

BPGM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length fusion protein

BPGM Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human BPGM (NP_001715.1).
Modifications Unmodified