Products

View as table Download

Rabbit Polyclonal Anti-CDO1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDO1 antibody was raised against a 19 amino acid peptide near the amino terminus of human CDO1.

Rabbit Polyclonal Anti-Cdo1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Cdo1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cdo1. Synthetic peptide located within the following region: RTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPPFDTCHAFDQRTG

CDO1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CDO1

CDO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CDO1 (NP_001792.2).
Modifications Unmodified