Germany
Japan
United Kingdom
China
EDAR mouse monoclonal antibody, clone AT19E8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Products
View as table Download
EDAR mouse monoclonal antibody, clone AT19E8, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-EDAR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EDAR antibody: synthetic peptide directed towards the middle region of human EDAR. Synthetic peptide located within the following region: PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV |
Anti-EDAR Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 148-161 amino acids of Human Ectodysplasin-A receptor |
EDAR Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1). |
| Modifications | Unmodified |
EDAR Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-187 of human EDAR (NP_071731.1). |
| Modifications | Unmodified |
Recombinant Anti-EDAR (Clone EDAR12)
| Applications | ELISA, WB |
| Reactivities | Chicken, Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Recombinant Anti-EDAR (Clone EDAR12)
| Applications | ELISA, WB |
| Reactivities | Chicken, Human, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- EDAR
Applications
- WB