Rabbit polyclonal anti-EFNA5 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EFNA5. |
Rabbit polyclonal anti-EFNA5 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EFNA5. |
Rabbit Polyclonal Anti-EFNA5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFNA5 Antibody: A synthesized peptide derived from human EFNA5 |
Ephrin A5 (EFNA5) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-EFNA5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFNA5 antibody is: synthetic peptide directed towards the N-terminal region of Human EFNA5. Synthetic peptide located within the following region: EDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFS |
Rabbit Polyclonal Anti-EFNA5 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EFNA5 antibody is: synthetic peptide directed towards the middle region of Human EFNA5. Synthetic peptide located within the following region: FDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPG |