Products

View as table Download

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: LLEGPLRLSPLLPGGGGRGSRGPGNPLDHQITNERGESSCDRLTDPHRAP

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the N terminal of human CTAGE5. Synthetic peptide located within the following region: DEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKM

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: PPRGFPPYLPPRPGFFPPPPHSEGRSEFPSGLIPPSNEPATEHPEPQQET

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: KLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHD

Rabbit polyclonal anti-MIA2 antibody

Applications WB
Reactivities Human
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MIA2.

Anti-Human MIA-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Immunogen E.coli derived Recombinant Human MIA-2

CTAGE5 (MIA2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 774-804 amino acids from the C-terminal region of human CTAGE5

Rabbit Polyclonal Anti-MIA2 Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-MIA2 antibody: synthetic peptide directed towards the C terminal of human MIA2. Synthetic peptide located within the following region: NTKVMIFKSSYSLSDMVSNIELPTRIHEEVYFEPSSSKDSDENSKPSVDT

Rabbit Polyclonal Anti-CTAGE5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CTAGE5

MIA2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human CTAGE5

MIA2 Rabbit polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthesized peptide derived from MIA2 at AA range: 361-410