Products

View as table Download

Rabbit Polyclonal Anti-PLXNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLXNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLXNB3. Synthetic peptide located within the following region: DYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKL

PLXNB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1250 of human PLXNB3 (NP_001156729.1).
Modifications Unmodified

PLXNB3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1050-1250 of human PLXNB3 (NP_001156729.1).
Modifications Unmodified