Products

View as table Download

TAS1R1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 322-351 amino acids from the Central region of human TAS1R1

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the C-terminal region of Human TAS1R1. Synthetic peptide located within the following region: NINETKIQWHGKDNQVPKSVCSSDCLEGHQRVVTGFHHCCFECVPCGAGT

Rabbit Polyclonal Anti-TAS1R1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAS1R1 antibody is: synthetic peptide directed towards the middle region of Human TAS1R1. Synthetic peptide located within the following region: QKRAVPGLKAFEEAYARADKKAPRPCHKGSWCSSNQLCRECQAFMAHTMP

TAS1R1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 330-567 of human TAS1R1 (NP_619642.2).
Modifications Unmodified