CYP2E1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2E1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CYP2E1 (untagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CYP2E1 (GFP-tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
Rabbit polyclonal Cytochrome P450 2E1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Cytochrome P450 2E1. |
Modifications | Phospho-specific |
CYP2E1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI5F11 (formerly 5F11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CYP2E1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CYP2E1 |
USD 379.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5F11 (formerly 5F11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 159.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI9E6 (formerly 9E6)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |