Germany
Japan
United Kingdom
China
CYP2E1 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CYP2E1 (untagged)-Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CYP2E1 (GFP-tagged) - Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cytochrome P450, family 2, subfamily E, polypeptide 1 (CYP2E1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP2E1 antibody: synthetic peptide directed towards the C terminal of human CYP2E1. Synthetic peptide located within the following region: QEFPDPEKFKPEHFLNENGKFKYSDYFKPFSTGKRVCAGEGLARMELFLL |
CYP2E1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 465.00
In Stock
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
USD 379.00
In Stock
USD 379.00
In Stock
USD 159.00
In Stock
USD 379.00
In Stock
Active filters
Target Symbol
- CYP2E1
Families
- P450
Availabilities
- In Stock