ABCA7 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCA7 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ABCA7 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Abca7 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
ABCA7 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |