Products

cDNA Clones (4)
Antibodies (1)
Jump to Filters
View as table Download
ABCA7 (NM_019112) Human Tagged ORF Clone
RC216823

USD 1,999.00

In Stock

ABCA7 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA7 (NM_019112) Human Tagged ORF Clone
RG216823

USD 2,200.00

In Stock

ABCA7 (GFP-tagged) - Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ABCA7 (NM_019112) Human Tagged Lenti ORF Clone
RC216823L1

USD 2,724.00

In Stock

Lenti ORF clone of Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ABCA7 Rabbit Polyclonal Antibody
TA331841

USD 375.00

In Stock

Rabbit Polyclonal Anti-Abca7 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL
ABCA7 (NM_019112) Human Untagged Clone
SC304674

USD 4,350.00

In Stock

ABCA7 (untagged)-Human ATP-binding cassette, sub-family A (ABC1), member 7 (ABCA7)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None