Products

cDNA Clones (15)
Antibodies (2)
Jump to Filters
View as table Download
Asph (NM_023066) Mouse Tagged ORF Clone
MR223585

USD 680.00

In Stock

Asph (Myc-DDK-tagged) - Mouse aspartate-beta-hydroxylase (Asph), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Asph (NM_133723) Mouse Tagged ORF Clone
MR224410

USD 220.00

In Stock

Asph (Myc-DDK-tagged) - Mouse aspartate-beta-hydroxylase (Asph), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspartate beta hydroxylase (ASPH) (NM_032467) Human Tagged ORF Clone
RC224881

USD 420.00

In Stock

ASPH (Myc-DDK-tagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Aspartate beta hydroxylase (ASPH) (NM_004318) Human Untagged Clone
SC314625

USD 1,550.00

In Stock

ASPH (untagged)-Human aspartate beta-hydroxylase (ASPH), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA337291

USD 375.00

In Stock

Rabbit Polyclonal Anti-ASPH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the middle region of human ASPH. Synthetic peptide located within the following region: PEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQ
Aspartate beta hydroxylase (ASPH) Rabbit Polyclonal Antibody
TA339207

USD 310.00

In Stock

Rabbit Polyclonal Anti-ASPH

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPH antibody: synthetic peptide directed towards the N terminal of human ASPH. Synthetic peptide located within the following region: SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE