Products

View as table Download

Rabbit anti-PGRMC1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PGRMC1

Goat Polyclonal Antibody against PGRMC1 / MPR

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPKDESARKND, from the C Terminus of the protein sequence according to NP_006658.1.

Rabbit Polyclonal Anti-PGRMC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ

PGRMC1 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PGRMC1

PGRMC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PGRMC1