Chicken Polyclonal ENC-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ENC-1 antibody was raised against a 13 amino acid peptide near the center of human ENC-1. |
Chicken Polyclonal ENC-1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ENC-1 antibody was raised against a 13 amino acid peptide near the center of human ENC-1. |
Rabbit Polyclonal Anti-ENC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENC1 Antibody: synthetic peptide directed towards the N terminal of human ENC1. Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL |
ENC1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ENC1 (NP_003624.1). |
Modifications | Unmodified |