Products

View as table Download

Rabbit polyclonal anti-GIPR antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GIPR.

Rabbit polyclonal GIPR Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR.

Rabbit Polyclonal Anti-GIPR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GIPR antibody is: synthetic peptide directed towards the N-terminal region of Human GIPR. Synthetic peptide located within the following region: LRLSLCGLLLQRAETGSKGQTAGELYQRWERYRRECQETLAAAEPPSVAA

Rabbit Polyclonal Anti-GIPR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human GIPR

GIPR Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-138 of human GIPR (NP_000155.1).
Modifications Unmodified