Products

Jump to Filters
View as table Download
NKD2 Rabbit Polyclonal Antibody
TA344088

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-NKD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKD2 antibody: synthetic peptide directed towards the N terminal of human NKD2. Synthetic peptide located within the following region: ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER
NKD2 Rabbit Polyclonal Antibody
TA366199

USD 380.00

4 Weeks

NKD2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human NKD2
NKD2 Rabbit Polyclonal Antibody
TA370552

USD 380.00

4 Weeks

NKD2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NKD2