Products

View as table Download

YWHAQ Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human YWHAQ

Goat Polyclonal Antibody against YWHAQ

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DDRKQTIDNSQ, from the internal region of the protein sequence according to NP_006817.1.

Rabbit Polyclonal Anti-YWHAQ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC

Rabbit polyclonal anti-14-3-3 theta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide

YWHAQ Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human YWHAQ

14-3-3 theta Rabbit polyclonal Antibody

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human 14-3-3 Theta

14-3-3 theta Rabbit monoclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

14-3-3 θ/τ (phospho-S232) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human 14-3-3 θ/τ around the phosphorylation site of Serine 232