Products

cDNA Clones (14)
Proteins (8)
Antibodies (2)
Jump to Filters
View as table Download
NKD2 Rabbit Polyclonal Antibody
TA344088

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-NKD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKD2 antibody: synthetic peptide directed towards the N terminal of human NKD2. Synthetic peptide located within the following region: ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER
NKD2 (C-term) Rabbit Polyclonal Antibody
AP52886PU-N

USD 450.00

2 Weeks

NKD2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 373-401aa) of human NKD2