Products

View as table Download

Rabbit Polyclonal antibody to RALA (v-ral simian leukemia viral oncogene homolog A (ras related))

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALA (Uniprot ID#P11233)

Rabbit polyclonal Anti-RALA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV

Rabbit anti RalA (pS196) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti RalA (Paired S196) Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-RALA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-155 amino acids of human v-ral simian leukemia viral oncogene homolog A (ras related)