Rabbit anti-PGRMC1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PGRMC1 |
Rabbit anti-PGRMC1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PGRMC1 |
Goat Polyclonal Antibody against PGRMC1 / MPR
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EPKDESARKND, from the C Terminus of the protein sequence according to NP_006658.1. |
Rabbit Polyclonal Anti-PGRMC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PGRMC1 antibody: synthetic peptide directed towards the N terminal of human PGRMC1. Synthetic peptide located within the following region: MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ |