Products

cDNA Clones (49)
Proteins (34)
Antibodies (14)
Jump to Filters
View as table Download
CD299 (CLEC4M) Rabbit Polyclonal Antibody
TA346481

USD 410.00

5 Days

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the N terminal of human CLEC4M. Synthetic peptide located within the following region: LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV
CD299 Rabbit Polyclonal Antibody
TA346480

USD 475.00

5 Days

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the n terminal of human CLEC4M. Synthetic peptide located within the following region: MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA
CD299 (CLEC4M) Rabbit Polyclonal Antibody
TA346482

USD 475.00

5 Days

Rabbit Polyclonal Anti-CLEC4M Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the middle region of human CLEC4M. Synthetic peptide located within the following region: NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS
CD299 (CLEC4M) Rabbit Polyclonal Antibody
TA329529

USD 375.00

5 Days

Rabbit Polyclonal anti-CLEC4M antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLEC4M antibody: synthetic peptide directed towards the middle region of human CLEC4M. Synthetic peptide located within the following region: CYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWM
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI10C3]
CF810055

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLEC4M mouse monoclonal antibody,clone OTI10C3

Applications IHC
Reactivities Human
Conjugation Unconjugated
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI7D12]
CF810067

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CLEC4M mouse monoclonal antibody,clone OTI7D12

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
CD299 (CLEC4M) Mouse Monoclonal Antibody [Clone ID: OTI10C3]
TA810055

USD 379.00

In Stock

CLEC4M mouse monoclonal antibody,clone OTI10C3

Applications IHC
Reactivities Human
Conjugation Unconjugated