Products

cDNA Clones (14)
Proteins (12)
Antibodies (1)
Jump to Filters
View as table Download
Transmembrane protein 93 (EMC6) Rabbit Polyclonal Antibody
TA335434

USD 375.00

5 Days

Rabbit Polyclonal Anti-TMEM93 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TMEM93 Antibody: synthetic peptide directed towards the N terminal of human TMEM93. Synthetic peptide located within the following region: AAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYG