GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL |
GFRAL (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 366-394 amino acids from the C-terminal region of human GFRAL |
Rabbit Polyclonal Anti-GFRAL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA |