Products

cDNA Clones (11)
Proteins (5)
Antibodies (2)
Jump to Filters
View as table Download
MOGAT2 Goat Polyclonal Antibody
TA311530

USD 375.00

5 Days

Goat Anti-MOGAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KESAAHILNRK, from the internal region of the protein sequence according to NP_079374.2.
MOGAT2 Rabbit Polyclonal Antibody
TA338697

USD 375.00

5 Days

Rabbit Polyclonal Anti-MOGAT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOGAT2 antibody: synthetic peptide directed towards the middle region of human MOGAT2. Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN