Products

cDNA Clones (11)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
TM6SF2 Rabbit Polyclonal Antibody
TA335280

USD 375.00

5 Days

Rabbit Polyclonal Anti-TM6SF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TM6SF2 antibody is: synthetic peptide directed towards the C-terminal region of Human TM6SF2. Synthetic peptide located within the following region: FFTLFRGLVVLDCPTDACFVYIYQYEPYLRDPVAYPKVQMLMYMFYVLPF