Products

View as table Download

Rabbit polyclonal CAV2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CAV2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 11-44 amino acids from the N-terminal region of human CAV2.

Rabbit Polyclonal antibody to Caveolin 2 (caveolin 2)

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 45 of Caveolin 2

USD 320.00

In Stock

Goat Polyclonal Anti-CAV2 Antibody

Applications IF, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant peptide derived from within residues 50 aa to the N-terminus of human CAV2 produced in E. coli.

Rabbit Polyclonal Anti-Caveolin 2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Caveolin 2 Antibody: A synthesized peptide derived from human Caveolin 2

Rabbit Polyclonal Anti-Caveolin 2 (Phospho-Tyr27) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Caveolin 2 (Phospho-Tyr27) Antibody: A synthesized peptide derived from human Caveolin 2 (Phospho-Tyr27)
Modifications Phospho-specific

Rabbit polyclonal Caveolin 2 (Tyr27) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caveolin 2 around the phosphorylation site of tyrosine 27 (L-E-YP-A-D).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CAV2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CAV2 antibody: synthetic peptide directed towards the N terminal of human CAV2. Synthetic peptide located within the following region: LVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSE

Caveolin-2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAV2
Modifications Unmodified

Caveolin 2 Rabbit polyclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Caveolin-2