Goat Polyclonal Antibody against LHX2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NLEGHEPHSPSQ, from the C Terminus of the protein sequence according to NP_004780.3. |
Goat Polyclonal Antibody against LHX2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NLEGHEPHSPSQ, from the C Terminus of the protein sequence according to NP_004780.3. |
Rabbit Polyclonal Anti-LHX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LHX2 antibody: synthetic peptide directed towards the middle region of human LHX2. Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA |
Rabbit Polyclonal Anti-Lhx2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Lhx2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lhx2. Synthetic peptide located within the following region: SNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLT |
LHX2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 337-406 of human LHX2 (NP_004780.3). |
Modifications | Unmodified |