Products

View as table Download

Goat Polyclonal Antibody against LHX2

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NLEGHEPHSPSQ, from the C Terminus of the protein sequence according to NP_004780.3.

Rabbit Polyclonal Anti-LHX2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHX2 antibody: synthetic peptide directed towards the middle region of human LHX2. Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA

Rabbit Polyclonal Anti-Lhx2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Lhx2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Lhx2. Synthetic peptide located within the following region: SNASLSPSSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLT

LHX2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 337-406 of human LHX2 (NP_004780.3).
Modifications Unmodified