Products

View as table Download

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 13 amino acid peptide from near the amino terminus of human VISA.

Rabbit anti-MAVS Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAVS

Rabbit Polyclonal Anti-MAVS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ

Rabbit Polyclonal VISA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VISA antibody was raised against a 17 amino acid peptide from near the center of human VISA.

Rabbit Polyclonal Anti-MAVS Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAVSantibody: synthetic peptide directed towards the N terminal of human VISA. Synthetic peptide located within the following region: ETQAPESPGENSEQALQTLSPRAIPRNPDGGPLESSSDLAALSPLTSSGH

Rabbit Polyclonal Anti-MAVS Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS

MAVS rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAVS