Products

View as table Download

Rabbit polyclonal antibody to E2F1 (E2F transcription factor 1)

Applications IF, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 133 and 362 of E2F1 (Uniprot ID#Q01094)

Mouse Monoclonal E2F-1 Antibody

Applications IF, IP, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal E2F1 Antibody

Applications ELISA, IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal Anti-E2F-1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1

Rabbit polyclonal E2F-1 phospho S364 antibody

Applications IHC, WB
Reactivities Chimpanzee, Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 360-369 of Human E2F-1.

Rabbit Polyclonal E2F1 (Thr433) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human E2F1 around the phosphorylation site of Threonine 433
Modifications Phospho-specific

Rabbit Polyclonal E2F1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human E2F1

E2F1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 400-450 of Human E2F-1.

Rabbit Polyclonal Anti-E2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the N terminal of human E2F1. Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA

Goat Polyclonal Anti-Transcription factor E2F1 (aa314-327) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region of NP_005216.1 (QEVTSEEENRATDS)

Anti-E2F1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1

Rabbit Polyclonal Anti-E2F1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the C terminal of human E2F1. Synthetic peptide located within the following region: REDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF