Products

View as table Download

Rabbit polyclonal anti-RPL28 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RPL28.

Rabbit Polyclonal Anti-RPL28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPL28. Synthetic peptide located within the following region: LIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSS

Rabbit Polyclonal Anti-RPL28 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPL28. Synthetic peptide located within the following region: SSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV