Rabbit Polyclonal Anti-RNASE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1. Synthetic peptide located within the following region: MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST |
Rabbit Polyclonal Anti-RNASE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the N terminal of human RNASE1. Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS |
RNASE1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RNASE1 |
RNASE1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RNASE1 |
Germany
Japan
United Kingdom
China