ARV1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human ARV1. |
ARV1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Bovine, Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human ARV1. |
Rabbit Polyclonal Anti-ARV1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARV1 antibody: synthetic peptide directed towards the middle region of human ARV1. Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD |