Products

View as table Download

ARV1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse
Immunogen KLH conjugated synthetic peptide between 23-51 amino acids from the N-terminal region of human ARV1.

Rabbit Polyclonal Anti-ARV1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARV1 antibody: synthetic peptide directed towards the middle region of human ARV1. Synthetic peptide located within the following region: QAIRVTLNINRKLSFLAVLSGLLLESIMVYFFQSMEWDVGSDYAIFKSQD