Products

View as table Download

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7

Rabbit Polyclonal Anti-Bmp7 Antibody

Applications IHC, WB
Reactivities Human
Immunogen The immunogen for anti-Bmp7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ

Rabbit Polyclonal Anti-BMP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BMP7 antibody: synthetic peptide directed towards the N terminal of human BMP7. Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.

BMP7 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Highly pure (>95%) recombinant Human BMP-7 (Ala316-His431) derived from E. coli.

Rabbit anti-BMP7 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BMP7