Rabbit anti-CAMK4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAMK4 |
Rabbit anti-CAMK4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAMK4 |
CAMKIV (CAMK4) mouse monoclonal antibody, clone 1A3, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal CaMK4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK4 |
Rabbit Polyclonal CaMK4 (Thr196/200) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CaMK4 around the phosphorylation site of Threonine 196/200 |
Modifications | Phospho-specific |
Rabbit polyclonal CaM Kinase IV antibody
Applications | IHC, WB |
Reactivities | Bovine, Chimpanzee, Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | This antiserum was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 305-323 of Human CaM Kinase IV protein. |
Rabbit Polyclonal Anti-CAMK4 Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-CAMK4 antibody: synthetic peptide directed towards the C terminal of mouse CAMK4. Synthetic peptide located within the following region: VKAVVASSRLGSASSSHTSIQENHKASSDPPSTQDAKDSTDLLGKKMQEE |
Rabbit Polyclonal Anti-Camk4 Antibody
Applications | WB |
Reactivities | Mouse |
Immunogen | The immunogen for Anti-Camk4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Camk4. Synthetic peptide located within the following region: DSTDLLGKKMQEEDQEEDQVEAEASADEMRKLQSEEVEKDAGVKEEETSS |
Rabbit anti CaM Kinase IV Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from aa 457-474 of rat CaM Kinase IV. |
Rabbit Polyclonal Anti-CAMK4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAMK4 |
CAMK4 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CAMK4 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
CAMK4 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAMK4 |
CAMK4 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAMK4 |
CAMK4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CAMK4 |
CAMK4 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 304-473 of human CAMK4 (NP_001735.1). |