Products

View as table Download

Rabbit Polyclonal Anti-CPNE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPNE1 antibody: synthetic peptide directed towards the N terminal of human CPNE1. Synthetic peptide located within the following region: TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG

Rabbit Polyclonal Anti-CPNE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPNE1 antibody: synthetic peptide directed towards the middle region of human CPNE1. Synthetic peptide located within the following region: VQCSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSG

Goat Anti-CPNE1 / Copine 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-APLKPLPPSAKDPA, from the C Terminus of the protein sequence according to NP_690902.1; NP_003906.2.

CPNE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-220 of human CPNE1 (NP_003906.2).
Modifications Unmodified