Products

View as table Download

Rabbit Polyclonal Anti-CSNK1G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1G3 antibody: synthetic peptide directed towards the middle region of human CSNK1G3. Synthetic peptide located within the following region: LEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP

CSNK1G3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 304-423 of human CSNK1G3 (NP_001026982.1).
Modifications Unmodified