Products

View as table Download

Rabbit Polyclonal Anti-ENDOD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENDOD1 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENDOD1. Synthetic peptide located within the following region: DLQKLLPFNPQLFQNNCGETEQDTEKMKKILEVVNQIQDEERMVQSQKSS

ENDOD1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human ENDOD1

ENDOD1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-330 of human ENDOD1 (NP_055851.1).
Modifications Unmodified