Products

View as table Download

Rabbit Polyclonal Anti-FBXO16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO16 antibody: synthetic peptide directed towards the N terminal of human FBXO16. Synthetic peptide located within the following region: CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA

Rabbit Polyclonal Anti-FBXO16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXO16 antibody: synthetic peptide directed towards the C terminal of human FBXO16. Synthetic peptide located within the following region: SPLSAFRSSSSLRKKNNSGEKALPPWRSSDKHPTDIIRFNYLDNRDPMET

FBXO16 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FBXO16